Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 8c (Taar8c)

This Recombinant Rat Trace amine-associated receptor 8c (Taar8c) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 8c, TaR-8c, Trace amine receptor 8c, Trace amine receptor 10, TaR-10

UniProt

Q923Y0

Expression Region

1-344

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAMGIENLV SALNCVGGCQVVVNQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGSKGE SSLESHKARVAKRERKAAKTLGVTVLAFIVSWLPYTIDTLIDAFMGFITPAYVYEFCCWS AYYNSAMNPLIYAFFYPWFRKAMKLILSGKILKGHSSTTSLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tktl1 Mouse Gene Knockout Kit (CRISPR)
KN517604 1 Kit

Tktl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SCF Antibody
RC-15425-01 50 μL

Recombinant SCF Antibody

Sign In for Pricing
View Details
Recombinant SCF Antibody
RC-15425-02 100 µL

Recombinant SCF Antibody

Sign In for Pricing
View Details
Recombinant SCF Antibody
RC-15425-03 1 mL

Recombinant SCF Antibody

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2503), 0.2mg/mL
BNUB2503-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2503), 0.2mg/mL

Sign In for Pricing
View Details
NAT8L (NM_178557) Human Over-expression Lysate
LC403615 20 µg

NAT8L (NM_178557) Human Over-expression Lysate

Sign In for Pricing
View Details