Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta C-C chemokine receptor-like 2 (CCRL2)

This Recombinant Macaca mulatta C-C chemokine receptor-like 2 (CCRL2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

C-C chemokine receptor-like 2

UniProt

Q9XSD7

Expression Region

1-344

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDRYDTWALSAQLVPSLCSAVFVVGVLDNLLVV LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF NCLLTLQRYLVFLHKGNFFSVRRRVPCGIVTSAVAWVTAILATVPEFAVYKPQMEDPKYK CAFSRTPFLPADETFWKHFLTLKMNVSVLVFPLFIFTFLYVQMRKTLRFGEQRYSLFKLV FAIMVVFLLMWAPYNIALFLSTFKEHFSLSDCKSNYNLDKSVLITKLIATTHCCVNPLLY VFLDGTFRKYLCRFFHRRSNTPRQPRRRFAQGTSREEPDRSTEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details