Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class H-72 (srh-72)

This Recombinant Serpentine receptor class H-72 (srh-72) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Serpentine receptor class H-72, Protein srh-72

UniProt

P91536

Expression Region

1-344

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEASLSTYYTTIYPTKCPPDPRFLVSKEGLAFCCQIIGFISLPMHFFTGYCILMKTPAT MKHVKLSLVNLNIWYIISQVIVSFFITSYNFYPSLASFSVGYATALNFPTVVQICILYTI NDAVHVSITLLFEIRSSLILKNRFRISSSRGRGYWLAGNFFGTVFITSPVFFNLADQNAE KMKILEAIPCPSKEFFLEPITVFATSGAWNTYLLISRSLKSIYMLQIIFFTSCCIYYLVI VKTDQVSAQTRRIQARSFYGLIIQTLIPAAFTLIPSVLISSRSAPDQLVNNLVSISYAVH IVVGSLAILLVHHPYRLFIKSIFVKSKESVIVPVVSTSMFKVIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal MED20 Antibody
H00009477-B01P 0.05 mg

Mouse Polyclonal MED20 Antibody

Sign In for Pricing
View Details
ADAMTS5 (NM_007038) Human Tagged ORF Clone
RG210834 10 µg

ADAMTS5 (NM_007038) Human Tagged ORF Clone

Sign In for Pricing
View Details
Olr853 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV627969 1.0 µg DNA

Olr853 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PEX11G Antibody
CSB-PA070285-01 50 µg

PEX11G Antibody

Sign In for Pricing
View Details
PEX11G Antibody
CSB-PA070285-02 100 µg

PEX11G Antibody

Sign In for Pricing
View Details
Anti-POGLUT3 Antibody Picoband® Fluoro550 Conjugated
A15507-1-Fluoro550 100 µg/Vial

Anti-POGLUT3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details