Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class H-72 (srh-72)

This Recombinant Serpentine receptor class H-72 (srh-72) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Serpentine receptor class H-72, Protein srh-72

UniProt

P91536

Expression Region

1-344

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEASLSTYYTTIYPTKCPPDPRFLVSKEGLAFCCQIIGFISLPMHFFTGYCILMKTPAT MKHVKLSLVNLNIWYIISQVIVSFFITSYNFYPSLASFSVGYATALNFPTVVQICILYTI NDAVHVSITLLFEIRSSLILKNRFRISSSRGRGYWLAGNFFGTVFITSPVFFNLADQNAE KMKILEAIPCPSKEFFLEPITVFATSGAWNTYLLISRSLKSIYMLQIIFFTSCCIYYLVI VKTDQVSAQTRRIQARSFYGLIIQTLIPAAFTLIPSVLISSRSAPDQLVNNLVSISYAVH IVVGSLAILLVHHPYRLFIKSIFVKSKESVIVPVVSTSMFKVIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr771 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
33429154 3x 1.0 µg DNA

Olfr771 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MRPS24 Polyclonal Antibody
RD218786A-01 20 µL

MRPS24 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS24 Polyclonal Antibody
RD218786A-02 60 μL

MRPS24 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS24 Polyclonal Antibody
RD218786A-03 120 μL

MRPS24 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS24 Polyclonal Antibody
RD218786A-04 200 µL

MRPS24 Polyclonal Antibody

Sign In for Pricing
View Details
Trappc10 (NM_001081055) Mouse Tagged Lenti ORF Clone
MR225177L3 10 µg

Trappc10 (NM_001081055) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details