Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 6 (Taar6)

This Recombinant Mouse Trace amine-associated receptor 6 (Taar6) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 6, TaR-6, Trace amine receptor 6

UniProt

Q5QD13

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNSSPPTVLQLCYENVTGSCVKTPYSPGSRVILYAVFGFGAVLAVFGNLMVMISILHF KQLHSPTNFLIASLACADFGVGISVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICIGVSWILPLVYSGAVFYTGVYDDGLEEL SSALNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIENIGSKTES SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBEF1 Rabbit Polyclonal Antibody
orb324989 100 µL

PBEF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RIC3 Protein Lysate
OCOA18848-20UG 20 µg

RIC3 Protein Lysate

Sign In for Pricing
View Details
DNAJC27 Recombinant Protein (Human)
RP009598 100 µg

DNAJC27 Recombinant Protein (Human)

Sign In for Pricing
View Details
Noradrenaline/Norepinephrine Antibody
abx403186-01 100 µL

Noradrenaline/Norepinephrine Antibody

Sign In for Pricing
View Details
Noradrenaline/Norepinephrine Antibody
abx403186-02 200 µL

Noradrenaline/Norepinephrine Antibody

Sign In for Pricing
View Details
Noradrenaline/Norepinephrine Antibody
abx403186-03 1 mL

Noradrenaline/Norepinephrine Antibody

Sign In for Pricing
View Details