Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 6 (Taar6)

This Recombinant Mouse Trace amine-associated receptor 6 (Taar6) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 6, TaR-6, Trace amine receptor 6

UniProt

Q5QD13

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNSSPPTVLQLCYENVTGSCVKTPYSPGSRVILYAVFGFGAVLAVFGNLMVMISILHF KQLHSPTNFLIASLACADFGVGISVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICIGVSWILPLVYSGAVFYTGVYDDGLEEL SSALNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIENIGSKTES SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FLT3 (Tyr969) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-3151R-PerCP-Cy5.5 100 µL

Phospho-FLT3 (Tyr969) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
KRAS Peptide
DF6324-BP 1 mg

KRAS Peptide

Sign In for Pricing
View Details
ITI214 free base
M10556-01 1 g

ITI214 free base

Sign In for Pricing
View Details
ITI214 free base
M10556-02 200 mg

ITI214 free base

Sign In for Pricing
View Details
ITI214 free base
M10556-03 500 mg

ITI214 free base

Sign In for Pricing
View Details
ITI214 free base
M10556-04 50 mg

ITI214 free base

Sign In for Pricing
View Details