Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Membrane progestin receptor alpha (Paqr7)

This Recombinant Mouse Membrane progestin receptor alpha (Paqr7) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Membrane progestin receptor alpha, mPR alpha, PPAR-gamma-induced liver protein, Progestin and adipoQ receptor family member VII

UniProt

Q80ZE4

Expression Region

1-345

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMAVAQKFNHLLSSLWHVGQKPPQPEPVFTVDRAQVPPLFWKPYIYAGYRPLHQNWCFY FRTLFQRHNEAVNVWTHLLAALALLLRLIGLAASVDFREDPHALPLFFIVLASFTYLSFS AVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFL AWLSCAGSCYNKYSQKPGLLGRIFQEAPSALAYVLDISPVLHRIIVSPLPAEEDPALLYH KCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARR GIYEPLHARWPHNFSGLFLLTVASSSLTALLLSQLVRRKLHQKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details