Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2K2 (OR2K2)

This Recombinant Human Olfactory receptor 2K2 (OR2K2) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Olfactory receptor 2K2, HTPCRH06, Olfactory receptor OR9-17

UniProt

Q8NGT1

Expression Region

1-345

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEVVLFVFS LVMYLTTLLGNSTLILITILDSRLKTPMYLFLGNLSFMDICYTSASVPTLLVNLLSSQKT IIFSGCAVQMYLSLAMGSTECVLLAVMAYDRYVAICNPLRYSIIMNRCVCARMATVSWVT GCLTALLETSFALQIPLCGNLIDHFTCEILAVLKLACTSSLLMNTIMLVVSILLLPIPML LVCISYIFILSTILRITSAEGRNKAFSTCGAHLTVVILYYGAALSMYLKPSSSNAQKIDK IISLLYGVLTPMLNPIIYSLRNKEVKDAMKKLLGKITLHQTHEHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TAF1C Antibody
RC-5261-01 50 μL

Recombinant TAF1C Antibody

Sign In for Pricing
View Details
Recombinant TAF1C Antibody
RC-5261-02 100 µL

Recombinant TAF1C Antibody

Sign In for Pricing
View Details
Recombinant TAF1C Antibody
RC-5261-03 1 mL

Recombinant TAF1C Antibody

Sign In for Pricing
View Details
RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11B2]
TA500893BM 100 µL

RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11B2]

Sign In for Pricing
View Details
USH1C Antibody
KC-2306-01 50 μL

USH1C Antibody

Sign In for Pricing
View Details
USH1C Antibody
KC-2306-02 100 µL

USH1C Antibody

Sign In for Pricing
View Details