Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 6 (Taar6)

This Recombinant Rat Trace amine-associated receptor 6 (Taar6) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 6, TaR-6, Trace amine receptor 6, Trace amine receptor 4, TaR-4

UniProt

Q923Y5

Expression Region

1-345

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNSSPPAVLQLCYENVNGSCVKTPYSPGPRVLLYAVFGFGAVLAVFGNLLVMISILHF KQLHSPTNFLIASLACADFWVGVSVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICISISWILPLAYSGAVFYTGVYADGLEEV SDAVNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIETVGNKAES SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)
MBS2102884-01 5x 96 Tests

Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)
MBS2102884-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)
MBS2102884-03 10x 96 Tests

Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)
MBS2102884-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse 5',3'-Nucleotidase, Cytosolic (NT5C) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mir135b Mouse qPCR Template Standard (MI0000646)
MK300060 200 Reactions

Mir135b Mouse qPCR Template Standard (MI0000646)

Sign In for Pricing
View Details
Trim21 Mouse shRNA Plasmid (Locus ID 20821)
TL514859 1 Kit

Trim21 Mouse shRNA Plasmid (Locus ID 20821)

Sign In for Pricing
View Details