Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 6 (Taar6)

This Recombinant Rat Trace amine-associated receptor 6 (Taar6) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 6, TaR-6, Trace amine receptor 6, Trace amine receptor 4, TaR-4

UniProt

Q923Y5

Expression Region

1-345

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNSSPPAVLQLCYENVNGSCVKTPYSPGPRVLLYAVFGFGAVLAVFGNLLVMISILHF KQLHSPTNFLIASLACADFWVGVSVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICISISWILPLAYSGAVFYTGVYADGLEEV SDAVNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIETVGNKAES SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKCD02119-96W - N6AMT1 ELISA Kit (Human)
OKCD02119-96W 96 Well

OKCD02119-96W - N6AMT1 ELISA Kit (Human)

Sign In for Pricing
View Details
Gm14351 Protein Vector (Mouse) (pPM-C-HA)
21846024 500 ng

Gm14351 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-CSNK1G2 antibody
STJ29465 100 µl

Anti-CSNK1G2 antibody

Sign In for Pricing
View Details
Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, RFP) (25)
GTR15301130 1 Vial

Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Casein Kinase 2β Rabbit mAb
F2727-100uL*2 2x 100 μL

Casein Kinase 2β Rabbit mAb

Sign In for Pricing
View Details
CRYZ (Quinone Oxidoreductase, NADPH:quinone Reductase, Zeta-crystallin, CRYZ) (MaxLight 650) discontinued
302367-ML650 100 µL

CRYZ (Quinone Oxidoreductase, NADPH:quinone Reductase, Zeta-crystallin, CRYZ) (MaxLight 650) discontinued

Sign In for Pricing
View Details