Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 6 (Taar6)

This Recombinant Rat Trace amine-associated receptor 6 (Taar6) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 6, TaR-6, Trace amine receptor 6, Trace amine receptor 4, TaR-4

UniProt

Q923Y5

Expression Region

1-345

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNSSPPAVLQLCYENVNGSCVKTPYSPGPRVLLYAVFGFGAVLAVFGNLLVMISILHF KQLHSPTNFLIASLACADFWVGVSVMPFSMVRSIESCWYFGRSFCTFHTCCDVAFCYSSL FHLSFISIDRYIAVTDPLVYPTKFTVSVSGICISISWILPLAYSGAVFYTGVYADGLEEV SDAVNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFLVARQQAKKIETVGNKAES SSESYKARVARRERKAAKTLGITVVAFMISWLPYSIDSLVDAFMGFITPAYIYEICVWCA YYNSAMNPLIYALFYPWFKKAIKVIMSGQVFKNSSATMNLFSEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXF1 Human qPCR Primer Pair (NM_006362)
HP233919 200 Reactions

NXF1 Human qPCR Primer Pair (NM_006362)

Sign In for Pricing
View Details
Human Macrophage MigRation Inhibitory Factor ELISA Kit
MBS723479-01 48 Strip Well (Competitive)

Human Macrophage MigRation Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details
Human Macrophage MigRation Inhibitory Factor ELISA Kit
MBS723479-02 48 Strip Well (Sandwich)

Human Macrophage MigRation Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details
Human Macrophage MigRation Inhibitory Factor ELISA Kit
MBS723479-03 96 Strip Well (Competitive)

Human Macrophage MigRation Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details
Human Macrophage MigRation Inhibitory Factor ELISA Kit
MBS723479-04 96 Strip Well (Sandwich)

Human Macrophage MigRation Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details
Human Macrophage MigRation Inhibitory Factor ELISA Kit
MBS723479-05 5x 96 Strip Well (Competitive)

Human Macrophage MigRation Inhibitory Factor ELISA Kit

Sign In for Pricing
View Details