Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 1 (Grina)

This Recombinant Mouse Protein lifeguard 1 (Grina) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit

UniProt

Q9ESF4

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQPSPYGQPGYPHGPSP YPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYYDNQ DFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAI FFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCF TVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAV DTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEDD2 Protein Vector (Human) (pPM-C-His)
PV012104 500 ng

DEDD2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ACOT9 Knockout HEK293T Polyclonal Cells
ARG25585 1 Million

ACOT9 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
MIRacle™ hsa-miR-7159-5p miRNA Agomir/Antagomir
AM0150 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-7159-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
3- (piperidin-1-ylsulfonyl) benzenesulfonyl chloride
sc-344644 1 g

3- (piperidin-1-ylsulfonyl) benzenesulfonyl chloride

Sign In for Pricing
View Details
Rat Fatty Acid Binding Protein 2, Intestinal (FABP2) ELISA Kit
MBS2702022-01 24 Strip Well

Rat Fatty Acid Binding Protein 2, Intestinal (FABP2) ELISA Kit

Sign In for Pricing
View Details
Rat Fatty Acid Binding Protein 2, Intestinal (FABP2) ELISA Kit
MBS2702022-02 48 Well

Rat Fatty Acid Binding Protein 2, Intestinal (FABP2) ELISA Kit

Sign In for Pricing
View Details