Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 1 (Grina)

This Recombinant Mouse Protein lifeguard 1 (Grina) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit

UniProt

Q9ESF4

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQPSPYGQPGYPHGPSP YPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYYDNQ DFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAI FFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCF TVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAV DTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rxt3 Antibody
orb856114 2 mg

Rxt3 Antibody

Sign In for Pricing
View Details
Syntaxin 1B Recombinant Antibody, PerCP Conjugated
bsm-62032R-PerCP 100 µL

Syntaxin 1B Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Recombinant Human Kruppel-Like Factor 7
MBS145891-01 0.005 mg

Recombinant Human Kruppel-Like Factor 7

Sign In for Pricing
View Details
Recombinant Human Kruppel-Like Factor 7
MBS145891-02 0.02 mg

Recombinant Human Kruppel-Like Factor 7

Sign In for Pricing
View Details
Recombinant Human Kruppel-Like Factor 7
MBS145891-03 1 mg

Recombinant Human Kruppel-Like Factor 7

Sign In for Pricing
View Details
Recombinant Human Kruppel-Like Factor 7
MBS145891-04 5x 1 mg

Recombinant Human Kruppel-Like Factor 7

Sign In for Pricing
View Details