Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig C5a anaphylatoxin chemotactic receptor (C5AR1)

This Recombinant Guinea pig C5a anaphylatoxin chemotactic receptor (C5AR1) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD_antigen= CD88

UniProt

O70129

Expression Region

1-345

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMVTVSYDYDYNSTFLPDGFVDNYVERLSFGDLVAVVIMVVVFLVGVPGNALVVWVTACE ARRHINAIWFLNLAAADLLSCLALPILLVSTVHLNHWYFGDTACKVLPSLILLNMYTSIL LLATISADRLLLVLSPIWCQRFRGGCLAWTACGLAWVLALLLSSPSFLYRRTHNEHFSFK VYCVTDYGRDISKERAVALVRLLVGFIVPLITLTACYTFLLLRTWSRKATRSAKTVKVVV AVVSSFFVFWLPYQVTGILLAWHSPNSATYRNTKALDAVCVAFAYINCCINPIIYVVAGH GFQGRLLKSLPSVLRNVLTEESLDKRHQSFARSTVDTMPQKSESV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL
BNC882012-100 1x 100 µL

CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL
BNC400802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details