Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class T-55 (srt-55)

This Recombinant Serpentine receptor class T-55 (srt-55) spans the amino acid sequence from region 19-363.

Product Specifications

Product Name Alternative

Serpentine receptor class T-55, Protein srt-55

UniProt

P34571

Expression Region

19-363

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ICFDLKTLQCWPMEIQEMALMLTARNTARYDCSGKSKSEWYETGQKRLGWGIYYISSGLF FQLIGWPVIWVFITKFSMTNALKVYRIMVFIGLIEITEIWGNSVFPGFVAVFGEVYCTSP ILMTIVGKMTMVQWVLGSSSAAFLGFHRLCDMIQKLEWLVNTNTKTGLWLTVLFFYACYG SIFFDTVLFNSDYMAPLLDPMIGKQGIIYSNNFLYFHNIIVATTLILVYACLCTLWSSRE MNTSSLHVSKFQRSILLQSICISLTYAIPAISFVTMFVLPIPKWFFHVSDITYQLSGGLP FIMYICLNKRVREEFLHLLRVCRKAEKSQVAVIPLGNSTVSAFNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSC1 antibody
70R-31943 0.1 mg

TSSC1 antibody

Sign In for Pricing
View Details
Anti-FAM83D Antibody Picoband®
A08800-1 100 µg/Vial

Anti-FAM83D Antibody Picoband®

Sign In for Pricing
View Details
ADAM21 Conjugated Antibody
C36044 100 µL

ADAM21 Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Human MMP15 protein
MBS1562562-01 0.05 mg

Recombinant Human MMP15 protein

Sign In for Pricing
View Details
Recombinant Human MMP15 protein
MBS1562562-02 0.1 mg

Recombinant Human MMP15 protein

Sign In for Pricing
View Details
Recombinant Human MMP15 protein
MBS1562562-03 5x 0.1 mg

Recombinant Human MMP15 protein

Sign In for Pricing
View Details