Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-11 (srb-11)

This Recombinant Serpentine receptor class beta-11 (srb-11) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-11, Protein srb-11

UniProt

P46506

Expression Region

1-346

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYSSQACITAFNLAYNLVFQASNYYQMIISFCSVFPLIYFLLFKLSKSSFHGNLKTIFI SYFVSLVAFSMTHLTTSTTQIIKSIISTDNCDLIISPFPHKIWNFFILFFLTLSTFFPCS VTIERYFAMETAEKYEKASVVMGPILVGFNVLLNFCIIFNMLKDESYTDGNVSFSVIPAV AAQKAFTFFIIIFFVNLVDVIFDLILLRMNLKLKLQLKNSSLAVKYQLEEVYQSTKFSVF LILIHIISFGIYVSAVVFFRYFGNLIISDPDSLFGVRTFSTTIVPTYNFVIGSFSSFFNR IKLKKSEGATIQMSSTGKSGANNYDQAIFSIWNSVSGPIDRNVTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver: right lobe
CS716308 5x 5 µm

Tissue FFPE Sections, Liver: right lobe

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS808167 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
NAlpha-Boc-L-Ornithine Tert-butyl Ester Hydrochloride
TRC-O695560-50MG 50 mg

NAlpha-Boc-L-Ornithine Tert-butyl Ester Hydrochloride

Sign In for Pricing
View Details
CBLIF Antibody
KC-22766-01 50 μL

CBLIF Antibody

Sign In for Pricing
View Details
CBLIF Antibody
KC-22766-02 100 µL

CBLIF Antibody

Sign In for Pricing
View Details
CBLIF Antibody
KC-22766-03 1 mL

CBLIF Antibody

Sign In for Pricing
View Details