Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-11 (srb-11)

This Recombinant Serpentine receptor class beta-11 (srb-11) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-11, Protein srb-11

UniProt

P46506

Expression Region

1-346

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYSSQACITAFNLAYNLVFQASNYYQMIISFCSVFPLIYFLLFKLSKSSFHGNLKTIFI SYFVSLVAFSMTHLTTSTTQIIKSIISTDNCDLIISPFPHKIWNFFILFFLTLSTFFPCS VTIERYFAMETAEKYEKASVVMGPILVGFNVLLNFCIIFNMLKDESYTDGNVSFSVIPAV AAQKAFTFFIIIFFVNLVDVIFDLILLRMNLKLKLQLKNSSLAVKYQLEEVYQSTKFSVF LILIHIISFGIYVSAVVFFRYFGNLIISDPDSLFGVRTFSTTIVPTYNFVIGSFSSFFNR IKLKKSEGATIQMSSTGKSGANNYDQAIFSIWNSVSGPIDRNVTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3Alpha,5Beta)-3,17-Dihydroxypregnane-11,20-dione
TRC-D446880-25MG 25 mg

(3Alpha,5Beta)-3,17-Dihydroxypregnane-11,20-dione

Sign In for Pricing
View Details
HRH4 Antibody
8G372-AAT 50 µg

HRH4 Antibody

Sign In for Pricing
View Details
Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F7]
TA503967BM 100 µL

Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F7]

Sign In for Pricing
View Details
IRX2 Antibody
8C11651-AAT 50 µg

IRX2 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS807277 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Water Chiller BCHI-408
BCHI-408 Each

Water Chiller BCHI-408

Sign In for Pricing
View Details