Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-11 (srb-11)

This Recombinant Serpentine receptor class beta-11 (srb-11) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-11, Protein srb-11

UniProt

P46506

Expression Region

1-346

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYSSQACITAFNLAYNLVFQASNYYQMIISFCSVFPLIYFLLFKLSKSSFHGNLKTIFI SYFVSLVAFSMTHLTTSTTQIIKSIISTDNCDLIISPFPHKIWNFFILFFLTLSTFFPCS VTIERYFAMETAEKYEKASVVMGPILVGFNVLLNFCIIFNMLKDESYTDGNVSFSVIPAV AAQKAFTFFIIIFFVNLVDVIFDLILLRMNLKLKLQLKNSSLAVKYQLEEVYQSTKFSVF LILIHIISFGIYVSAVVFFRYFGNLIISDPDSLFGVRTFSTTIVPTYNFVIGSFSSFFNR IKLKKSEGATIQMSSTGKSGANNYDQAIFSIWNSVSGPIDRNVTLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), 1mg/mL
BNUM1600-50 1x 50 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), 1mg/mL

Sign In for Pricing
View Details
Mini Centrifuge BCMI-504
BCMI-504 1 Unit

Mini Centrifuge BCMI-504

Sign In for Pricing
View Details
Rnd3 Mouse Gene Knockout Kit (CRISPR)
KN514884 1 Kit

Rnd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBAP1 Human Gene Knockout Kit (CRISPR)
KN401858 1 Kit

UBAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF488A conjugate, 0.1mg/mL
BNC880685-100 1x 100 µL

CD68 (C68/684 + KP1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5,6-trans-Vitamin D2
TRC-V676060-25MG 25 mg

5,6-trans-Vitamin D2

Sign In for Pricing
View Details