Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hahella chejuensis Electron transport complex protein RnfD (rnfD)

This Recombinant Hahella chejuensis Electron transport complex protein RnfD (rnfD) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfD

UniProt

Q2SKU7

Expression Region

1-346

Origin

Hahella chejuensis (strain KCTC 2396)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLRITSPHLKGPARTTAIMQWVILATVPGLLTMTWFFGWGTLINVVLASLTAVAAEAF VLTLRKRPLAFYLRDYSAVLTGVLLGLALPPYAPWWVTFVGTAFAIIFAKQIYGGLGNNP FNPAMVGYALLLVSFPVAMTTNWATPRPLAEIPGFLEAFARIFWNADIGVDGYTMATPLD TYKHEIVAGTAETVFALPVFGARTALGWEWVNLAFLAGGLLLIWRKIITWHIPVSMLAAL ALCSLLLGWDEDKYAPLQLHLLAGATMLGAFFIATDPVSAATSKLGKLYYGAGVGILTYL IRTWGNYPDAVAFAVLLMNFAAPFLDYYTQPRTYGHRKARRGVKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details