Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Short-wave-sensitive opsin 1 (Opn1sw)

This Recombinant Rat Short-wave-sensitive opsin 1 (Opn1sw) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, S opsin, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP, Short wavelength-sensitive cone opsin

UniProt

Q63652

Expression Region

1-346

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEDEFYLFQNISSVGPWDGPQYHIAPVWAFHLQAAFMGFVFFAGTPLNATVLVATLHY KKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTG WSLAFLAFERYLVICKPFGNIRFNSKHALTVVLITWTIGIGVSIPPFFGWSRFIPEGLQC SCGPDWYTVGTKYRSEHYTWFLFIFCFIIPLSLICFSYFQLLRTLRAVAAQQQESATTQK AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLYLRLVTIPAFFSKSSCVYNPII YCFMNKQFRACILEMVCRKPMTDESDMSGSQKTEVSTVSSSKVGPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Setd2 Mouse Gene Knockout Kit (CRISPR)
KN315625BN 1 Kit

Setd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Serum Albumin Antibody
RC-16416-01 50 μL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
Recombinant Serum Albumin Antibody
RC-16416-02 100 µL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
Recombinant Serum Albumin Antibody
RC-16416-03 1 mL

Recombinant Serum Albumin Antibody

Sign In for Pricing
View Details
CD4 (C4/206), CF640R conjugate, 0.1mg/mL
BNC400206-100 1x 100 µL

CD4 (C4/206), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Buccutite™ FOL, NHS ester
5350-AAT 2 µmole

Buccutite™ FOL, NHS ester

Sign In for Pricing
View Details