Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Short-wave-sensitive opsin 1 (Opn1sw)

This Recombinant Rat Short-wave-sensitive opsin 1 (Opn1sw) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, S opsin, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP, Short wavelength-sensitive cone opsin

UniProt

Q63652

Expression Region

1-346

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEDEFYLFQNISSVGPWDGPQYHIAPVWAFHLQAAFMGFVFFAGTPLNATVLVATLHY KKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTG WSLAFLAFERYLVICKPFGNIRFNSKHALTVVLITWTIGIGVSIPPFFGWSRFIPEGLQC SCGPDWYTVGTKYRSEHYTWFLFIFCFIIPLSLICFSYFQLLRTLRAVAAQQQESATTQK AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLYLRLVTIPAFFSKSSCVYNPII YCFMNKQFRACILEMVCRKPMTDESDMSGSQKTEVSTVSSSKVGPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM2 (NM_001278114) Human Tagged ORF Clone
RG239281 10 µg

ADAM2 (NM_001278114) Human Tagged ORF Clone

Sign In for Pricing
View Details
Soil DNA Isolation Maxi Kit
62000 10 Preparations

Soil DNA Isolation Maxi Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS800320 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]
2118-AAT 1 mg

Tide Quencher™ 7.1WS maleimide [TQ7.1WS maleimide]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS644048 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
CAMKK2 Rabbit Polyclonal Antibody
TA361979 100 µL

CAMKK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details