Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Short-wave-sensitive opsin 1 (Opn1sw)

This Recombinant Mouse Short-wave-sensitive opsin 1 (Opn1sw) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Short-wave-sensitive opsin 1, S opsin, Blue cone photoreceptor pigment, Blue-sensitive opsin, BOP, Short wavelength-sensitive cone opsin

UniProt

P51491

Expression Region

1-346

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHY KKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTG WSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQK AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPII YCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2-B (E-8) Alexa Fluor® 488
sc-393395 AF488 200 µg/mL

SH2-B (E-8) Alexa Fluor® 488

Sign In for Pricing
View Details
C21orf32 Protein Vector (Human) (pPM-N-D-C-HA)
PV330512 500 ng

C21orf32 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
PRAM1 Polyclonal Antibody
bs-12676R 100 µL

PRAM1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Cholinesterase ELISA Kit
MBS9428676-01 96 Tests

Human Cholinesterase ELISA Kit

Sign In for Pricing
View Details
Human Cholinesterase ELISA Kit
MBS9428676-02 5x 96 Tests

Human Cholinesterase ELISA Kit

Sign In for Pricing
View Details
Spoon spatula, 22.5 cm long, both ends PTFE coated
1214765 1 Unit

Spoon spatula, 22.5 cm long, both ends PTFE coated

Sign In for Pricing
View Details