Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 42 (GPR42)

This Recombinant Human G-protein coupled receptor 42 (GPR42) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

G-protein coupled receptor 42

UniProt

O15529

Expression Region

1-346

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTAS DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAI LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGP YNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF640R conjugate, 0.1mg/mL
BNC400014-100 1x 100 µL

CD31 / PECAM-1 (C31.7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468), CF594 conjugate, 0.1mg/mL
BNC940468-100 1x 100 µL

CD8 (C8/468), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL
BNC741201-500 1x 500 µL

Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details