Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Free fatty acid receptor 3 (FFAR3)

This Recombinant Human Free fatty acid receptor 3 (FFAR3) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Free fatty acid receptor 3, G-protein coupled receptor 41

UniProt

O14843

Expression Region

1-346

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL
BNC400418-100 1x 100 µL

Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details