Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-20 (srg-20)

This Recombinant Serpentine receptor class gamma-20 (srg-20) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-20, Protein srg-20

UniProt

P91535

Expression Region

1-346

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTRLIIPANFSYDDPLPFTCNQDSHVMLSILEYLVQATYLSVSAVLNSMIVYTIFRCKG KHSYRRNPFFVLYAAEAVMNVYSCVIEVLFGRLIIYMTPLCPALSPFFFTPSILTKLYFL LNHYCLAFKTLSQIAISFNRMTCVIFPVHHFKLWQNILAPVLVSLFVLPLGVTWNILVSR VYVNPNGAGFSVNYRDAVAWANISFLHLFHCIPCLFLMIVFFLASIFGLTMLENRLRSAE RSLIIFTMTLGVETMLFAIAQIYFAFLAGYLPGIRPLMLLISFNVFDVLYVYSPIALILM NRQLRRDIFHLKGDDPGFGFTKFPVILVEMISDSSPHLLIINLQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEF6 (NM_022047) Human Recombinant Protein
TP317877 20 µg

DEF6 (NM_022047) Human Recombinant Protein

Sign In for Pricing
View Details
ALS2CR2 (STRADB) (C-term) Rabbit Polyclonal Antibody
AP13724PU-N 400 µL

ALS2CR2 (STRADB) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL
BNC402316-100 1x 100 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PELI1 Antibody
RC-5344-01 50 μL

Recombinant PELI1 Antibody

Sign In for Pricing
View Details
Recombinant PELI1 Antibody
RC-5344-02 100 µL

Recombinant PELI1 Antibody

Sign In for Pricing
View Details
Recombinant PELI1 Antibody
RC-5344-03 1 mL

Recombinant PELI1 Antibody

Sign In for Pricing
View Details