Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-20 (srg-20)

This Recombinant Serpentine receptor class gamma-20 (srg-20) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-20, Protein srg-20

UniProt

P91535

Expression Region

1-346

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTRLIIPANFSYDDPLPFTCNQDSHVMLSILEYLVQATYLSVSAVLNSMIVYTIFRCKG KHSYRRNPFFVLYAAEAVMNVYSCVIEVLFGRLIIYMTPLCPALSPFFFTPSILTKLYFL LNHYCLAFKTLSQIAISFNRMTCVIFPVHHFKLWQNILAPVLVSLFVLPLGVTWNILVSR VYVNPNGAGFSVNYRDAVAWANISFLHLFHCIPCLFLMIVFFLASIFGLTMLENRLRSAE RSLIIFTMTLGVETMLFAIAQIYFAFLAGYLPGIRPLMLLISFNVFDVLYVYSPIALILM NRQLRRDIFHLKGDDPGFGFTKFPVILVEMISDSSPHLLIINLQLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tal1 (BTL73), CF405S conjugate, 0.1mg/mL
BNC042852-500 1x 500 µL

Tal1 (BTL73), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prl7a1 Mouse Gene Knockout Kit (CRISPR)
KN513917 1 Kit

Prl7a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712770 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Pure Glycine max Lectin (Soybean) -SBA-
L-1301-5 1 mg

Pure Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details
Lysozyme Mouse Monoclonal Antibody [A5A8]
EM1901-98 100 µL

Lysozyme Mouse Monoclonal Antibody [A5A8]

Sign In for Pricing
View Details
GHRHR (NM_001009824) Human Over-expression Lysate
LY423140 100 µg

GHRHR (NM_001009824) Human Over-expression Lysate

Sign In for Pricing
View Details