Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Violet-sensitive opsin

This Recombinant Xenopus laevis Violet-sensitive opsin spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Violet-sensitive opsin, Violet cone opsin, Violet cone photoreceptor pigment

UniProt

P51473

Expression Region

1-347

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEEDFYLFKNVSNVSPFDGPQYHIAPKWAFTLQAIFMGMVFLIGTPLNFIVLLVTIKY KKLRQPLNYILVNITVGGFLMCIFSIFPVFVSSSQGYFFFGRIACSIDAFVGTLTGLVTG WSLAFLAFERYIVICKPMGNFNFSSSHALAVVICTWIIGIVVSVPPFLGWSRYMPEGLQC SCGPDWYTVGTKYRSEYYTWFIFIFCFVIPLSLICFSYGRLLGALRAVAAQQQESASTQK AEREVSRMVIFMVGSFCLCYVPYAAMAMYMVTNRNHGLDLRLVTIPAFFSKSSCVYNPII YSFMNKQFRGCIMETVCGRPMSDDSSVSSTSQRTEVSTVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human KCNK9 Antibody (SAA1716)
HV232013-01 50 µg

Anti-Human KCNK9 Antibody (SAA1716)

Sign In for Pricing
View Details
Anti-Human KCNK9 Antibody (SAA1716)
HV232013-02 100 µg

Anti-Human KCNK9 Antibody (SAA1716)

Sign In for Pricing
View Details
Anti-Human KCNK9 Antibody (SAA1716)
HV232013-03 1 mg

Anti-Human KCNK9 Antibody (SAA1716)

Sign In for Pricing
View Details
Yellowfever mosquito Prohibitin2 Rabbit Polyclonal Antibody (PE)
orb2572269 200 µL

Yellowfever mosquito Prohibitin2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Cxx1c AAV Vector (Mouse) (CMV)
17222104 1 µg

Cxx1c AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
NCOA5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
31572156 3x 1.0 µg DNA

NCOA5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details