Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Violet-sensitive opsin

This Recombinant Xenopus laevis Violet-sensitive opsin spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Violet-sensitive opsin, Violet cone opsin, Violet cone photoreceptor pigment

UniProt

P51473

Expression Region

1-347

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEEDFYLFKNVSNVSPFDGPQYHIAPKWAFTLQAIFMGMVFLIGTPLNFIVLLVTIKY KKLRQPLNYILVNITVGGFLMCIFSIFPVFVSSSQGYFFFGRIACSIDAFVGTLTGLVTG WSLAFLAFERYIVICKPMGNFNFSSSHALAVVICTWIIGIVVSVPPFLGWSRYMPEGLQC SCGPDWYTVGTKYRSEYYTWFIFIFCFVIPLSLICFSYGRLLGALRAVAAQQQESASTQK AEREVSRMVIFMVGSFCLCYVPYAAMAMYMVTNRNHGLDLRLVTIPAFFSKSSCVYNPII YSFMNKQFRGCIMETVCGRPMSDDSSVSSTSQRTEVSTVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Myoglobin
P4475-01 50 µg

Recombinant Mouse Myoglobin

Sign In for Pricing
View Details
Recombinant Mouse Myoglobin
P4475-02 200 µg

Recombinant Mouse Myoglobin

Sign In for Pricing
View Details
Recombinant Mouse Myoglobin
P4475-03 1 mg

Recombinant Mouse Myoglobin

Sign In for Pricing
View Details
Rabbit Anti-Human ARNT monoclonal antibody, clone TU16-36
CABT-L680 100 ul

Rabbit Anti-Human ARNT monoclonal antibody, clone TU16-36

Sign In for Pricing
View Details
SPRR1A sgRNA CRISPR Lentivector set (Human)
K2279401 3x 1.0 µg

SPRR1A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Hyaluronic Acid (HA) Antibody
abx170481-01 100 µL

Hyaluronic Acid (HA) Antibody

Sign In for Pricing
View Details