Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Ileal sodium/bile acid cotransporter (SLC10A2)

This Recombinant Rabbit Ileal sodium/bile acid cotransporter (SLC10A2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Ileal sodium/bile acid cotransporter, Apical sodium-dependent bile acid transporter, ASBT, Ileal Na (+) /bile acid cotransporter, Ileal sodium-dependent bile acid transporter, Short na

UniProt

Q28727

Expression Region

1-347

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Gastroenterology & Hepatology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNLTVGCLANATVCEGASCVAPESNFNAILSVVLSTVLTILLALVMFSMGCNVEIKKFL GHIRRPWGIFIGFLCQFGIMPLTGFVLAVAFGIMPIQAVVVLIMGCCPGGTASNILAYWV DGDMDLSVSMTTCSTLLALGMMPLCLYVYTKMWVDSGTIVIPYDNIGTSLVALVVPVSIG MFVNHKWPQKAKIILKVGSIAGAVLIVLIAVVGGILYQSAWIIEPKLWIIGTIFPMAGYS LGFFLARIAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLTYVFTFPLIYSIFQIA FAAIFLGIYVAYRKCHGKNDAEFPDIKDTKTEPESSFHQMNGGFQPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-500 1x 500 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details