Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Type IV secretion system protein virB6 (virB6)

This Recombinant Brucella abortus Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q2YJ76

Expression Region

1-347

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorophyllin Copper Trisodium Salt (Technical Grade)
TRC-C380235-25G 25 g

Chlorophyllin Copper Trisodium Salt (Technical Grade)

Sign In for Pricing
View Details
Fructose-phenylalanine (mixture of diastereomers)
TRC-F792560-10MG 10 mg

Fructose-phenylalanine (mixture of diastereomers)

Sign In for Pricing
View Details
NARS1 Rabbit Polyclonal Antibody
TA370392 100 µL

NARS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]
TA800437BM 100 µL

DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]

Sign In for Pricing
View Details
Human CDC42SE2 activation kit by CRISPRa
GA111322 1 Kit

Human CDC42SE2 activation kit by CRISPRa

Sign In for Pricing
View Details
ABT 199 (>99%)(Venetoclax)
TRC-A112425-500MG 500 mg

ABT 199 (>99%)(Venetoclax)

Sign In for Pricing
View Details