Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Type IV secretion system protein virB6 (virB6)

This Recombinant Brucella abortus Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q2YJ76

Expression Region

1-347

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM15 antibody
FNab08969 100 µg

TRIM15 antibody

Sign In for Pricing
View Details
PTPRZ1 Antibody
OC-359-01 50 μL

PTPRZ1 Antibody

Sign In for Pricing
View Details
PTPRZ1 Antibody
OC-359-02 100 µL

PTPRZ1 Antibody

Sign In for Pricing
View Details
PTPRZ1 Antibody
OC-359-03 1 mL

PTPRZ1 Antibody

Sign In for Pricing
View Details
Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody
HA601453 100 µL

Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
C20orf31 (EDEM2) (NM_018217) Human Over-expression Lysate
LY402658 100 µg

C20orf31 (EDEM2) (NM_018217) Human Over-expression Lysate

Sign In for Pricing
View Details