Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 4 (Taar4)

This Recombinant Mouse Trace amine-associated receptor 4 (Taar4) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 4, TaR-4, Trace amine receptor 4

UniProt

Q5QD15

Expression Region

1-347

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTPDPWSSPEVQFCFAAANSSCPRKARPALVVCAMYLIMIGAIVMTMLGNMAVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITTRVVGVFLLISWSVPIFFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGTVMVGIYIHIFTVAQKHARQIGTGPRTK QALSESKMKATSKKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIDFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5B Rabbit Polyclonal Antibody
ER1802-21 100 µL

KDM5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: 4C9]
AM26643AF-N 100 µg

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: 4C9]

Sign In for Pricing
View Details
HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: J2E1]
AM09063PU-S 50 µL

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: J2E1]

Sign In for Pricing
View Details
NIPSNAP3A (Center) Rabbit Polyclonal Antibody
AP52921PU-N 400 µL

NIPSNAP3A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(DHQD)2PHAL
TRC-D299905-5G 5 g

(DHQD)2PHAL

Sign In for Pricing
View Details
PE Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UD-01 25 µg

PE Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details