Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 4 (Taar4)

This Recombinant Mouse Trace amine-associated receptor 4 (Taar4) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 4, TaR-4, Trace amine receptor 4

UniProt

Q5QD15

Expression Region

1-347

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTPDPWSSPEVQFCFAAANSSCPRKARPALVVCAMYLIMIGAIVMTMLGNMAVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITTRVVGVFLLISWSVPIFFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGTVMVGIYIHIFTVAQKHARQIGTGPRTK QALSESKMKATSKKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIDFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NEFL) Mouse Monoclonal Antibody [Clone ID: OTI14B10]
CF814566 100 µg

Neurofilament (NEFL) Mouse Monoclonal Antibody [Clone ID: OTI14B10]

Sign In for Pricing
View Details
CRELD1 (NM_001077415) Human Over-expression Lysate
LC421411 20 µg

CRELD1 (NM_001077415) Human Over-expression Lysate

Sign In for Pricing
View Details
(1S,3R,4R)-Ethyl 3-((tert-Butoxycarbonyl)amino)-4-(2-((5-chloropyridin-2-yl)amino)-2-oxoacetamido)cyclohexanecarboxylate
TRC-E702880-25MG 25 mg

(1S,3R,4R)-Ethyl 3-((tert-Butoxycarbonyl)amino)-4-(2-((5-chloropyridin-2-yl)amino)-2-oxoacetamido)cyclohexanecarboxylate

Sign In for Pricing
View Details
LCE6A (NM_001128600) Human Recombinant Protein
TP324998M 100 µg

LCE6A (NM_001128600) Human Recombinant Protein

Sign In for Pricing
View Details
Cadherin 8 (CDH8) CytoSection
TS417249P5 25 Slides

Cadherin 8 (CDH8) CytoSection

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560771 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details