Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1L6 (OR1L6)

This Recombinant Human Olfactory receptor 1L6 (OR1L6) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 1L6, Olfactory receptor 1L7, Olfactory receptor OR9-30

UniProt

Q8NGR2

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYFYRLKLMKEAVLVKLPFTSLPLLLQTLSRKSRDMEIKNYSSSTSGFILLGLSSNPQL QKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLV NFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPRHCLL MLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTET LAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFSTCGSHLTAVALFYGSIIYVYFRPL SMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLQDRIYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC23 (SVBP) Human shRNA Plasmid Kit (Locus ID 374969)
TR319897 1 Kit

CCDC23 (SVBP) Human shRNA Plasmid Kit (Locus ID 374969)

Sign In for Pricing
View Details
anti-Anti-Frizzled 6
YF-PA25073 50 ul

anti-Anti-Frizzled 6

Sign In for Pricing
View Details
TRI41 rabbit pAb
E44H12370 100 µL

TRI41 rabbit pAb

Sign In for Pricing
View Details
HEXIM2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0948103 1.0 µg DNA

HEXIM2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
STRA6 polyclonal antibody
BS71643-01 50 µL

STRA6 polyclonal antibody

Sign In for Pricing
View Details
STRA6 polyclonal antibody
BS71643-02 100 µL

STRA6 polyclonal antibody

Sign In for Pricing
View Details