Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1L6 (OR1L6)

This Recombinant Human Olfactory receptor 1L6 (OR1L6) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 1L6, Olfactory receptor 1L7, Olfactory receptor OR9-30

UniProt

Q8NGR2

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYFYRLKLMKEAVLVKLPFTSLPLLLQTLSRKSRDMEIKNYSSSTSGFILLGLSSNPQL QKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLV NFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPRHCLL MLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTET LAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFSTCGSHLTAVALFYGSIIYVYFRPL SMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLQDRIYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) Antibody - With BSA and Azide
orb1462260-01 20 µg

Ep-CAM / CD326 (Epithelial Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) Antibody - With BSA and Azide
orb1462260-02 100 µg

Ep-CAM / CD326 (Epithelial Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
TLC Plates, Silica gel 60, Glass Backing, HF254, 2.5x7.5cm, pack of 320
SI56036 1 Each

TLC Plates, Silica gel 60, Glass Backing, HF254, 2.5x7.5cm, pack of 320

Sign In for Pricing
View Details
Human MCP1 Matched Antibody Pair Set [ABP-S-03939]
ABP-S-03939 5 Plates

Human MCP1 Matched Antibody Pair Set [ABP-S-03939]

Sign In for Pricing
View Details
MGC39633 Blocking Peptide
33R-9790 0.1 mg

MGC39633 Blocking Peptide

Sign In for Pricing
View Details
1-Butyl-3-methylimidazolium bis (pentafluoroethylsulfonyl) imide
IL-0321-HP-BULK 1 Each

1-Butyl-3-methylimidazolium bis (pentafluoroethylsulfonyl) imide

Sign In for Pricing
View Details