Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 4 (Taar4)

This Recombinant Rat Trace amine-associated receptor 4 (Taar4) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 4, TaR-4, Trace amine receptor 4, Trace amine receptor 2, TaR-2

UniProt

Q923Y7

Expression Region

1-347

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSPDLWYSPETQFCFAAANNSCPRKARPALVVCAMYLVMIGAIVMTMLGNMVVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMVRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITVGVVGVFLLISWSVPILFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGAIMVGIYIHIFTVARKHARKIGPGPRTK RALSESKMKATSGKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIGFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2b,  10nm
GM-302-10 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2b, 10nm

Sign In for Pricing
View Details
MILR1 Antibody (Biotin)
KB-3679-01 50 μL

MILR1 Antibody (Biotin)

Sign In for Pricing
View Details
MILR1 Antibody (Biotin)
KB-3679-02 100 µL

MILR1 Antibody (Biotin)

Sign In for Pricing
View Details
MILR1 Antibody (Biotin)
KB-3679-03 1 mL

MILR1 Antibody (Biotin)

Sign In for Pricing
View Details
SPDEF (NM_012391) Human Recombinant Protein
TP305688L 1 mg

SPDEF (NM_012391) Human Recombinant Protein

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details