Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 4 (Taar4)

This Recombinant Rat Trace amine-associated receptor 4 (Taar4) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 4, TaR-4, Trace amine receptor 4, Trace amine receptor 2, TaR-2

UniProt

Q923Y7

Expression Region

1-347

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSPDLWYSPETQFCFAAANNSCPRKARPALVVCAMYLVMIGAIVMTMLGNMVVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMVRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITVGVVGVFLLISWSVPILFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGAIMVGIYIHIFTVARKHARKIGPGPRTK RALSESKMKATSGKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIGFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]
TA812949 100 µL

ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]

Sign In for Pricing
View Details
CDKN2A Antibody
KC-167-01 50 μL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-167-02 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-167-03 1 mL

CDKN2A Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504258 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
OPA1 Recombinant Rabbit monoclonal Antibody
HA751078 100 µL

OPA1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details