Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 4 (Taar4)

This Recombinant Rat Trace amine-associated receptor 4 (Taar4) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 4, TaR-4, Trace amine receptor 4, Trace amine receptor 2, TaR-2

UniProt

Q923Y7

Expression Region

1-347

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSPDLWYSPETQFCFAAANNSCPRKARPALVVCAMYLVMIGAIVMTMLGNMVVIISIAH FKQLHSPTNFLILSMATTDFLLSCVVMPFSMVRSIESCWYFGDLFCKVHSCCDIMLCTTS IFHLCFISVDRHYAVCDPLHYVTQITVGVVGVFLLISWSVPILFAFGLVFSELNLIGAED FVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGAIMVGIYIHIFTVARKHARKIGPGPRTK RALSESKMKATSGKESKATKTLSIVMGVFVLCWLPFFVLTITDPFIGFTTPEDLYNVFLW LGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNRHR Rabbit Polyclonal Antibody
TA360913 100 µL

GNRHR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE2C (NM_007019) Human Recombinant Protein
TP308741M 100 µg

UBE2C (NM_007019) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Xirp1 activation kit by CRISPRa
GA204651 1 Kit

Mouse Xirp1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS644809 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Human Autophagy Related Protein 12 (ATG12) ELISA Kit
RDR-ATG12-Hu-01 96 Tests

Human Autophagy Related Protein 12 (ATG12) ELISA Kit

Sign In for Pricing
View Details
Human Autophagy Related Protein 12 (ATG12) ELISA Kit
RDR-ATG12-Hu-02 48 Tests

Human Autophagy Related Protein 12 (ATG12) ELISA Kit

Sign In for Pricing
View Details