Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-2 (srb-2)

This Recombinant Serpentine receptor class beta-2 (srb-2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-2, Protein srb-2

UniProt

Q95ZY1

Expression Region

1-347

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHIQILEYENECQLANEVTYHPVYRIAQLWTFVVSILAIPALYIFLMKRILPLPFHGNI KFLLVCYFSASFVFAVLLAFLFSYHVVAPLFITSMCDLIIRPSLYKVGNLSLTLFMTIQM IMPLGFSIERFIALSMTKSYENVRTFLGPLLVFTLIGIDLALLYHVFRDEKFEDSFISFA LVPETSAIPFNSYFWELLYAEIGNFICNCIFLLVHSKFKARFLHQQRSLSVRYLLEEISQ TSKFTLIVSFTHLLFVGWYLIATIFVRTIGEDFFGGYIHYTVARGVHITVPTYNLTIVFV GIKALSFMNLRRQNNVQSKVQIRSTGAEGARNYEDAIANYWNFVSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 6 (GPC6) (C-term) Rabbit Polyclonal Antibody
AP51904PU-N 400 µL

Glypican 6 (GPC6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXO44 (NM_183413) Human Recombinant Protein
TP319237M 100 µg

FBXO44 (NM_183413) Human Recombinant Protein

Sign In for Pricing
View Details
KIAA0495 (NM_207306) Human Recombinant Protein
TP310801L 1 mg

KIAA0495 (NM_207306) Human Recombinant Protein

Sign In for Pricing
View Details
Human NOP53 activation kit by CRISPRa
GA109368 1 Kit

Human NOP53 activation kit by CRISPRa

Sign In for Pricing
View Details
Rhenium Carbonyl
TRC-R315015-250MG 250 mg

Rhenium Carbonyl

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF594 conjugate, 0.1mg/mL
BNC941790-100 1x 100 µL

CD79a (B-Cell Marker) (IGA/1790R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details