Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-2 (srb-2)

This Recombinant Serpentine receptor class beta-2 (srb-2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-2, Protein srb-2

UniProt

Q95ZY1

Expression Region

1-347

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHIQILEYENECQLANEVTYHPVYRIAQLWTFVVSILAIPALYIFLMKRILPLPFHGNI KFLLVCYFSASFVFAVLLAFLFSYHVVAPLFITSMCDLIIRPSLYKVGNLSLTLFMTIQM IMPLGFSIERFIALSMTKSYENVRTFLGPLLVFTLIGIDLALLYHVFRDEKFEDSFISFA LVPETSAIPFNSYFWELLYAEIGNFICNCIFLLVHSKFKARFLHQQRSLSVRYLLEEISQ TSKFTLIVSFTHLLFVGWYLIATIFVRTIGEDFFGGYIHYTVARGVHITVPTYNLTIVFV GIKALSFMNLRRQNNVQSKVQIRSTGAEGARNYEDAIANYWNFVSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAR1B Polyclonal Antibody
E-AB-16033-01 20 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-16033-02 60 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-16033-03 120 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-16033-04 200 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
H3C14 Rabbit Polyclonal Antibody
TA397500 50 µg

H3C14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CaMK2α/β/δ (Ab-305) Antibody
8B0005-AAT 50 µg

CaMK2α/β/δ (Ab-305) Antibody

Sign In for Pricing
View Details