Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M2 (OR2M2)

This Recombinant Human Olfactory receptor 2M2 (OR2M2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 2M2, OST423

UniProt

Q96R28

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAY DRYIAICHPLRYTNLMNPKICGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCE FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIIASYARVILAVIHMGSGEGRCKAFTT CSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA FMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT20 Antibody (C-term)
orb1927256-01 50 µL

KRT20 Antibody (C-term)

Sign In for Pricing
View Details
KRT20 Antibody (C-term)
orb1927256-02 100 µL

KRT20 Antibody (C-term)

Sign In for Pricing
View Details
Olr964 Protein Vector (Rat) (pPM-C-HA)
34805026 500 ng

Olr964 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PLV3-EF1a-NKX3-2-Puro Plasmid
PVT71715 2 µg

PLV3-EF1a-NKX3-2-Puro Plasmid

Sign In for Pricing
View Details
MCM6 (Minichromosome Maintenance Protein 6, DNA Replication Licensing Factor MCM6, MCG40308, Minichromosome Maintenance Deficient (mis5 S. pombe) 6, MIS5 Homolog, P105MCM) (MaxLight 750) discontinued
M2749-36F-ML750 100 µL

MCM6 (Minichromosome Maintenance Protein 6, DNA Replication Licensing Factor MCM6, MCG40308, Minichromosome Maintenance Deficient (mis5 S. pombe) 6, MIS5 Homolog, P105MCM) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MPPE1 (Metallophosphoesterase 1, Post-GPI Attachment to Proteins Factor 5, PGAP5, PP579) (PE)
MBS6385840-01 0.1 mL

MPPE1 (Metallophosphoesterase 1, Post-GPI Attachment to Proteins Factor 5, PGAP5, PP579) (PE)

Sign In for Pricing
View Details