Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M2 (OR2M2)

This Recombinant Human Olfactory receptor 2M2 (OR2M2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 2M2, OST423

UniProt

Q96R28

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAY DRYIAICHPLRYTNLMNPKICGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCE FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIIASYARVILAVIHMGSGEGRCKAFTT CSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA FMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC14 (NM_001098612) Human Tagged ORF Clone Lentiviral Particle
RC224202L1V 200 µL

SIGLEC14 (NM_001098612) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCL21 Protein, Rhesus, Recombinant
PK54104I0 50 µg

CCL21 Protein, Rhesus, Recombinant

Sign In for Pricing
View Details
IgM Antibody
OARA05206-1MG 1 mg

IgM Antibody

Sign In for Pricing
View Details
2810006K23Rik Mouse shRNA Plasmid (Locus ID 72650)
TL518830 1 Kit

2810006K23Rik Mouse shRNA Plasmid (Locus ID 72650)

Sign In for Pricing
View Details
S- (-) -2-Chloropropionic Acid (L- (a) -chloropropionic acid)
C5029-56 2 g

S- (-) -2-Chloropropionic Acid (L- (a) -chloropropionic acid)

Sign In for Pricing
View Details
Anti-Putative read through protein P5 Polyclonal Antibody
PVV06601 100 μg

Anti-Putative read through protein P5 Polyclonal Antibody

Sign In for Pricing
View Details