Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M2 (OR2M2)

This Recombinant Human Olfactory receptor 2M2 (OR2M2) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Olfactory receptor 2M2, OST423

UniProt

Q96R28

Expression Region

1-347

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAY DRYIAICHPLRYTNLMNPKICGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCE FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIIASYARVILAVIHMGSGEGRCKAFTT CSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA FMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF148 Human siRNA Oligo Duplex (Locus ID 378925)
SR317870 1 Kit

RNF148 Human siRNA Oligo Duplex (Locus ID 378925)

Sign In for Pricing
View Details
OKRC01199-96W - IL-10 ELISA Kit (Mouse)
OKRC01199-96W 96 Well

OKRC01199-96W - IL-10 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Zorifertinib (AZD3759)
S7971-100mg 100 mg

Zorifertinib (AZD3759)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS604622 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
NMDAε2 HDR Plasmid (h)
sc-400654-HDR 20 µg

NMDAε2 HDR Plasmid (h)

Sign In for Pricing
View Details
PATZ1 (NM_014323) Human Recombinant Protein
TP760945 50 µg

PATZ1 (NM_014323) Human Recombinant Protein

Sign In for Pricing
View Details