Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB6 (virB6)

This Recombinant Brucella suis biovar 1 Type IV secretion system protein virB6 (virB6) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB6

UniProt

Q9RPX9

Expression Region

1-347

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP3 Mouse Monoclonal Antibody [Clone ID: OTI3B9]
CF807469 100 µg

IGFBP3 Mouse Monoclonal Antibody [Clone ID: OTI3B9]

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF647 conjugate, 0.1mg/mL
BNC472886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Pro-Neuregulin-1/NRG1-β1 Protein (aa 176-246)
PKSH032942-01 10 µg

Recombinant Human Pro-Neuregulin-1/NRG1-β1 Protein (aa 176-246)

Sign In for Pricing
View Details
Recombinant Human Pro-Neuregulin-1/NRG1-β1 Protein (aa 176-246)
PKSH032942-02 50 µg

Recombinant Human Pro-Neuregulin-1/NRG1-β1 Protein (aa 176-246)

Sign In for Pricing
View Details
Zfp574 Mouse Gene Knockout Kit (CRISPR)
KN519885 1 Kit

Zfp574 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DYKDDDDK tag, AlpHcAbs® Mouse IgG1
HA710227 100 µg

DYKDDDDK tag, AlpHcAbs® Mouse IgG1

Sign In for Pricing
View Details