Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1)

This Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

C5a anaphylatoxin chemotactic receptor, C5a-R, C5aR, CD_antigen= CD88

UniProt

P30993

Expression Region

1-347

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVWVTAF EPDGPSNAIWFLNLAVADLLSCLAMPVLFTTVLNHNYWYFDATACIVLPSLILLNMYASI LLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKDFYSE HTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKATRSTKTLKV VMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPIIYVMA GQGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTDDTSPRKSQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sim2 shRNA (UAS) - Lentiviral mouse Sim2 shRNA (UAS, GFP) (100)
GTR15253857 1 Vial

Lentiviral mouse Sim2 shRNA (UAS) - Lentiviral mouse Sim2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Human SIRPG Protein, His Tag
32-18158-100 100 µg

Recombinant Human SIRPG Protein, His Tag

Sign In for Pricing
View Details
RPAP3 Antibody
E035926 100 µg -100 µL

RPAP3 Antibody

Sign In for Pricing
View Details
StARD10 shRNA Plasmid (h)
sc-106575-SH 20 µg

StARD10 shRNA Plasmid (h)

Sign In for Pricing
View Details
Perfluoro-3,6,9-trioxaundecane-1,11-dioic acid
PC7492-01 5 g

Perfluoro-3,6,9-trioxaundecane-1,11-dioic acid

Sign In for Pricing
View Details
Perfluoro-3,6,9-trioxaundecane-1,11-dioic acid
PC7492-02 10 g

Perfluoro-3,6,9-trioxaundecane-1,11-dioic acid

Sign In for Pricing
View Details