Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-7 (srb-7)

This Recombinant Serpentine receptor class beta-7 (srb-7) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-7, Protein srb-7

UniProt

P54142

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESSTNIPLACITAYELSFHPVYRNFQIYQLIMLFSSLFPLTYFILFQLLKSSFHGNLK SLLVGYFGAILVFSVVFLVEAFIQVLLPFISEQKCDLLIQPKYYKLGNLLGCLLMTIPTF FPISITFERLIATKMADDYEKTRVFLGPILAIFLVLLDLFLILLIYKEAIVTGGSISFVF IPASIASKMYMFFIMMLILNSFNFFFSFLLLRRNAQLKKSNSTLAAKFQLEEVYSSTKFS ISVIFVHVTFFGSYTTITILLRYFGSYFFSDPIDLGAVRGAFMTMISSYNFAVGVASVYF NYIYRIKKIIEIKGNIRIVATGQAGAINYDKAIFNIWNSTSSTNNTSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p8 (NUPR1) (NM_012385) Human Tagged ORF Clone Lentiviral Particle
RC200585L2V 200 µL

p8 (NUPR1) (NM_012385) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Histone H4 (tri methyl K20) Recombinant Rabbit mAb
E47M52112 100 µL

Histone H4 (tri methyl K20) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Filaggrin Rabbit pAb, PE-Cy5.5 conjugated
orb2877870 100 µL

Filaggrin Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Human LTF Protein, His Tag
E40KMPH2570 20 µg

Human LTF Protein, His Tag

Sign In for Pricing
View Details
TXNDC15 (Thioredoxin Domain-Containing Protein 15, Thioredoxin Domain-Containing 15)
494939 100 µL

TXNDC15 (Thioredoxin Domain-Containing Protein 15, Thioredoxin Domain-Containing 15)

Sign In for Pricing
View Details
FGL2 Rabbit pAb, PerCP-Cy7 conjugated
orb2861334 100 µL

FGL2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details