Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-7 (srb-7)

This Recombinant Serpentine receptor class beta-7 (srb-7) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-7, Protein srb-7

UniProt

P54142

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESSTNIPLACITAYELSFHPVYRNFQIYQLIMLFSSLFPLTYFILFQLLKSSFHGNLK SLLVGYFGAILVFSVVFLVEAFIQVLLPFISEQKCDLLIQPKYYKLGNLLGCLLMTIPTF FPISITFERLIATKMADDYEKTRVFLGPILAIFLVLLDLFLILLIYKEAIVTGGSISFVF IPASIASKMYMFFIMMLILNSFNFFFSFLLLRRNAQLKKSNSTLAAKFQLEEVYSSTKFS ISVIFVHVTFFGSYTTITILLRYFGSYFFSDPIDLGAVRGAFMTMISSYNFAVGVASVYF NYIYRIKKIIEIKGNIRIVATGQAGAINYDKAIFNIWNSTSSTNNTSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKX Protein Vector (Human) (pPM-C-His)
PV026056 500 ng

MKX Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CHMP2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0446106 1.0 µg DNA

CHMP2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human JMY shRNA (UAS) - Lentiviral human JMY shRNA (UAS) (100)
GTR15323553 1 Vial

Lentiviral human JMY shRNA (UAS) - Lentiviral human JMY shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Human HDAC2 Protein, His, Insect-2ug
QP12202-2ug 2ug

Recombinant Human HDAC2 Protein, His, Insect-2ug

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
MBS7029610-01 0.02 mg

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)
MBS7029610-02 0.1 mg

Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)

Sign In for Pricing
View Details