Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Rhodopsin (RHO)

This Recombinant Cat Rhodopsin (RHO) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q95KU1

Expression Region

1-348

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTGSKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARNP Antibody
MBS7121040-01 0.05 mg

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
MBS7121040-02 0.1 mg

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
MBS7121040-03 5x 0.1 mg

SARNP Antibody

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit
DL-FABP8-Hu-01 48 Tests

Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit
DL-FABP8-Hu-02 96 Tests

Human Fatty Acid Binding Protein 8, Myelin (FABP8) ELISA Kit

Sign In for Pricing
View Details
SEC14L2 CRISPR/Cas9 KO Plasmid (m)
sc-426755 20 µg

SEC14L2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details