Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysophosphatidic acid receptor 2 (Lpar2)

This Recombinant Mouse Lysophosphatidic acid receptor 2 (Lpar2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 2, LPA receptor 2, LPA-2, Lysophosphatidic acid receptor Edg-4

UniProt

Q9JL06

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPPHCQALHQRLVPATGPAGHQPHGVSGHTA GIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVP LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV VIILGAFVVCWTPGQVVLLLDGLDCKTCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR RTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY1 Polyclonal Antibody
MBS9432860-01 0.05 mL

HEY1 Polyclonal Antibody

Sign In for Pricing
View Details
HEY1 Polyclonal Antibody
MBS9432860-02 0.1 mL

HEY1 Polyclonal Antibody

Sign In for Pricing
View Details
HEY1 Polyclonal Antibody
MBS9432860-03 5x 0.1 mL

HEY1 Polyclonal Antibody

Sign In for Pricing
View Details
TCP1 delta Antibody / CCT4
R32421 100 µg

TCP1 delta Antibody / CCT4

Sign In for Pricing
View Details
MEK2 Rabbit Polyclonal Antibody (Cy5.5)
orb1053664 100 µL

MEK2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Otud5 (NM_001037496) Rat Tagged ORF Clone Lentiviral Particle
RR204496L4V 200 µL

Otud5 (NM_001037496) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details