Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysophosphatidic acid receptor 2 (Lpar2)

This Recombinant Mouse Lysophosphatidic acid receptor 2 (Lpar2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 2, LPA receptor 2, LPA-2, Lysophosphatidic acid receptor Edg-4

UniProt

Q9JL06

Expression Region

1-348

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPPHCQALHQRLVPATGPAGHQPHGVSGHTA GIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVP LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV VIILGAFVVCWTPGQVVLLLDGLDCKTCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR RTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Minpp1 ELISA Kit
EF018997 96 Tests

Rat Minpp1 ELISA Kit

Sign In for Pricing
View Details
Rutin trihydrate
GW5081-5g 5 g

Rutin trihydrate

Sign In for Pricing
View Details
QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating])
MBS642262-01 0.2 mL

QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating])

Sign In for Pricing
View Details
QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating])
MBS642262-02 5x 0.2 mL

QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating])

Sign In for Pricing
View Details
LIPM (NM_001128215) Human Recombinant Protein
TP325684L 1 mg

LIPM (NM_001128215) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-SP3  (2E8)
YF-MA15553 100 ug

Anti-SP3 (2E8)

Sign In for Pricing
View Details