Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Ileal sodium/bile acid cotransporter (SLC10A2)

This Recombinant Cricetulus griseus Ileal sodium/bile acid cotransporter (SLC10A2) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Ileal sodium/bile acid cotransporter, Apical sodium-dependent bile acid transporter, ASBT, Ileal Na (+) /bile acid cotransporter, Ileal sodium-dependent bile acid transporter, Short na

UniProt

Q60414

Expression Region

1-348

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Gastroenterology & Hepatology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSSICNPNATICEGDSCIAPESNFNAILSVVMSTVLTILLALVMFSMGCNVELHKFLG HLRRPWGIVVGFLCQFGIMPLTGFVLSVAFGILPVQAVVVLIQGCCPGGTASNILAYWVD GDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGTSLVALVIPVSIGM YVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWTIEPKLWIIGTIYPIAGYGL GFFLARIAGQPWYRCRTVALETGLQNTQLCSTIVQLSFSPEDLNLVFTFPLIYSIFQIAF AAILLGAYVAYKKCHGKNNTELQEKTDNEMEPRSSFQETNKGFQPDEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-100 1x 100 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL
BNC040693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF488A conjugate, 0.1mg/mL
BNC881497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF594 conjugate, 0.1mg/mL
BNC942590-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), CF647 conjugate, 0.1mg/mL
BNC470781-500 1x 500 µL

Carbonic Anhydrase IX (CA9/781), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details